Pay in 4 interest-free payments of $53.12 Learn more
Ships within 48 hours · Estimated delivery Aug 2 - Aug 7
wound healing and tumor invasion
Specificity: RNUXA Antibody detects endogenous levels of total RNUXA
using NCOA4 antibody at 1:450 dilution
AGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE
Specificity: Phospho-Progesterone Receptor (Ser345) Antibody detects endogenous levels of Progesterone Receptor only when phosphorylated at Ser345
TIMM44 Monoclonal Antibody-MB11695 Biopharmaceutical manufacturing wound healing and tumor invasionTIMM44 Monoclonal Antibody Sizes: 50l, 100l Catalogue Numbers: MB11695 50, MB11695 100 Product: 50mM Tris Glycine(pH 7. 4), 0. 15M NaCl, 40% Glycerol, 0. 01% Sodium azide and 0. 05% BSA Swiss Prot: O43615 Host: Rabbit Reactivity: Human Applications: WB, ICC IF, IP, All Applications: WB: 1 500 1 1000 IF: 1 50 1 200 IP: 1 20 Background: Essential component of the PAM complex, a complex required for the translocation of transit peptide containing
US$ 42.95
US$ 42.95
US$ 37.95