Quiet essentials · Free shipping over $75 · Shop the edit

CD7 Monoclonal Antibody-MB65995 Size:50µl Gene Name: GPR19

SKU: 30868618059

4.8
USD181.70 USD209.70

Pay in 4 interest-free payments of $45.42 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 2 - Aug 7

Description

Gene Name: GPR19

blood cells of various types

AA Sequence: MNSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHt VMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS

and some tumors

Swiss-Prot: Q8WXD0

CD7 Monoclonal Antibody-MB65995 Size:50µl Gene Name: GPR19CD7 Monoclonal Antibody Sizes: 50l, 100l Catalogue Numbers: MB65995 50, MB65995 100 Product: Mouse IgG1. Liquid in PBS containing 50% glycerol, 0. 2% BSA and 0. 01% sodium azide. Swiss Prot: P09564 Host: Mouse Reactivity: Human Applications: IHC All Applications: IHC (1 100 1 300) Background: CD7 is a type I transmembrane glycoprotein belonging to the immunoglobulin superfamily. CD7 is one of the earliest surface markers to be expressed on the surface

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products