Pay in 4 interest-free payments of $41.86 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
SLC6A8 Polyclonal Antibody
Background: GTPase-activating proteins (GAPs) accelerate the intrinsic rate of GTP hydrolysis of Ras-related proteins
AA Sequence: VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTL
Immunogen: A synthesized peptide derived from human UBF1 around the phosphorylation site of Thr117
MCSF Receptor Antibody
DGCR6L Polyclonal Antibody-BS72698 Size:50µl SLC6A8 Polyclonal AntibodyDGCR6L Polyclonal Antibody Sizes: 50l, 100l Catalogue Numbers: BS72698 50, BS72698 100 Product: 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Swiss Prot: Q9BY27 Host: Rabbit Reactivity: Human, Mouse, Rat Applications: WB All Applications: WB,1: 500 1: 2000 Background: This gene, the result of a duplication at this locus, is one of two functional genes encoding nearly identical proteins that have similar expression patterns. The product